PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G38860.1
Common NameBHLH141, BIM3, EN127, K15E6.40, K15E6.7
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family bHLH
Protein Properties Length: 298aa    MW: 33950.3 Da    PI: 5.5977
Description BES1-interacting Myc-like protein 3
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G38860.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH56.93.7e-183586255
                 HHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
          HLH  2 rrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                 r +h+e E+rRR++iN++f+ L +++P++  ++++K +Ka+ L +++eYI+ Lq
  AT5G38860.1 35 RSKHSETEQRRRSKINERFQSLMDIIPQN--QNDQKRDKASFLLEVIEYIHFLQ 86
                 899*************************6..4********************99 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474593.27E-2031114IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000834.10E-173190No hitNo description
PROSITE profilePS5088817.0153385IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.107.7E-2235106IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.2E-153586IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.0E-133991IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006351Biological Processtranscription, DNA-templated
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0000293anatomyguard cell
Sequence ? help Back to Top
Protein Sequence    Length: 298 aa     Download sequence    Send to blast
MNSHDIDDQL EADVYSNLPS RNDSSTGRRN RNSCRSKHSE TEQRRRSKIN ERFQSLMDII  60
PQNQNDQKRD KASFLLEVIE YIHFLQEKVH MYEDSHQMWY QSPTKLIPWR NSHGSVAEEN  120
DHPQIVKSFS SNDKVAASSG FLLDTYNSVN PDIDSAVSTK IPEHSPVSAV SSYLRTEPSL  180
QFVQHDFWQP KTSCGTINCF TNELLTSDEK TSASLSTVCS QRVLNTLTEA LKSSGVNMSE  240
TMISVQLSLR KREDREYSVA AFASEDNGNS IADEEGDSPT ETRSFCNDID HSQKRIRR
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
At.504950.0floral meristem
Expression -- Microarray ? help Back to Top
Source ID
Expression AtlasAT5G38860
AtGenExpressAT5G38860
Functional Description ? help Back to Top
Source Description
UniProtPositive brassinosteroid-signaling protein.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00534DAP27203113Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G38860.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Regulation -- Hormone ? help Back to Top
Source Hormone
AHDbrassinosteroid
Interaction -- BIND ? help Back to Top
Source Intact With Description
BINDAT1G19350An unspecified isoform of BES1 interacts with BIM3.
Interaction ? help Back to Top
Source Intact With
BioGRIDAT1G19350
IntActSearch Q9FMB6
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G38860
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ6304990.0AJ630499.1 Arabidopsis thaliana mRNA for hypothetical protein, clone At5g38860.
GenBankBT0331310.0BT033131.1 Arabidopsis thaliana unknown protein (At5g38860) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198702.20.0transcription factor BIM3
SwissprotQ9FMB60.0BIM3_ARATH; Transcription factor BIM3
TrEMBLD7MJT91e-177D7MJT9_ARALL; Putative uncharacterized protein
STRINGAT5G38860.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM161311114
Representative plantOGRP13601747
Publications ? help Back to Top
  1. Riechmann JL, et al.
    Arabidopsis transcription factors: genome-wide comparative analysis among eukaryotes.
    Science, 2000. 290(5499): p. 2105-10
    [PMID:11118137]
  2. Heim MA, et al.
    The basic helix-loop-helix transcription factor family in plants: a genome-wide study of protein structure and functional diversity.
    Mol. Biol. Evol., 2003. 20(5): p. 735-47
    [PMID:12679534]
  3. Toledo-Ortiz G,Huq E,Quail PH
    The Arabidopsis basic/helix-loop-helix transcription factor family.
    Plant Cell, 2003. 15(8): p. 1749-70
    [PMID:12897250]
  4. Bailey PC, et al.
    Update on the basic helix-loop-helix transcription factor gene family in Arabidopsis thaliana.
    Plant Cell, 2003. 15(11): p. 2497-502
    [PMID:14600211]
  5. Gong W, et al.
    Genome-wide ORFeome cloning and analysis of Arabidopsis transcription factor genes.
    Plant Physiol., 2004. 135(2): p. 773-82
    [PMID:15208423]
  6. Yin Y, et al.
    A new class of transcription factors mediates brassinosteroid-regulated gene expression in Arabidopsis.
    Cell, 2005. 120(2): p. 249-59
    [PMID:15680330]
  7. Cifuentes-Esquivel N, et al.
    The bHLH proteins BEE and BIM positively modulate the shade avoidance syndrome in Arabidopsis seedlings.
    Plant J., 2013. 75(6): p. 989-1002
    [PMID:23763263]